| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() automatically mapped to Pfam PF00347 |
| Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
| Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
| Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
| Domain d1yi2e1: 1yi2 E:1-79 [123234] Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1 automatically matched to d1ffk11 complexed with cd, cl, ery, k, mg, na; mutant |
PDB Entry: 1yi2 (more details), 2.65 Å
SCOPe Domain Sequences for d1yi2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi2e1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg
Timeline for d1yi2e1:
View in 3DDomains from other chains: (mouse over for more information) d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1 |