Lineage for d1yi2c1 (1yi2 C:1-246)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691529Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 691530Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 691531Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 691532Protein Ribosomal protein L4 [52168] (2 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 691533Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (44 PDB entries)
  8. 691540Domain d1yi2c1: 1yi2 C:1-246 [123232]
    Other proteins in same PDB: d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1jj2c_
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2c1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: Crystal Structure Of Erythromycin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (C:) 50S ribosomal protein L4E

SCOP Domain Sequences for d1yi2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2c1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d1yi2c1:

Click to download the PDB-style file with coordinates for d1yi2c1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2c1: