| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species) |
| Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (6 PDB entries) Uniprot P17597 460-667 |
| Domain d1yi1a3: 1yi1 A:460-667 [123226] Other proteins in same PDB: d1yi1a1, d1yi1a2 automated match to d1ybha3 complexed with 1tb, fad, mg, nhe, p22 |
PDB Entry: 1yi1 (more details), 2.9 Å
SCOPe Domain Sequences for d1yi1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi1a3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr
Timeline for d1yi1a3: