| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
| Protein Acetohydroxyacid synthase catalytic subunit [88733] (2 species) |
| Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142204] (6 PDB entries) |
| Domain d1yi0a2: 1yi0 A:86-280 [123222] Other proteins in same PDB: d1yi0a1, d1yi0a3 automatically matched to 1YBH A:86-280 complexed with 1sm, fad, mg, nhe, p22 |
PDB Entry: 1yi0 (more details), 2.7 Å
SCOP Domain Sequences for d1yi0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi0a2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
nweqamrlpgymsrm
Timeline for d1yi0a2: