SCOPe 2.06: Domain d1yhza1: 1yhz A:281-459

Lineage for d1yhza1 (1yhz A:281-459)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (11 PDB entries)
   Uniprot P17597 281-459

8. Domain d1yhza1: 1yhz A:281-459 [123218]
   Other proteins in same PDB: d1yhza2, d1yhza3
   automated match to d1ybha1
   complexed with 1cs, fad, mg, nhe, p22

Details for d1yhza1

PDB Entry: 1yhz, 2.7 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide, Chlorsulfuron

PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1yhza1:

Sequence; same for both SEQRES and ATOM records:

>d1yhza1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

Timeline for d1yhza1:

• d1yhza1 first appeared in SCOP 1.73
  
• d1yhza1 appears in SCOPe 2.05
  
• d1yhza1 appears in SCOPe 2.07
  
• d1yhza1 appears in the current release, SCOPe 2.08