Lineage for d1yhya2 (1yhy A:86-280)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864566Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2864567Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)
  7. 2864596Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142204] (12 PDB entries)
    Uniprot P17597 86-280
  8. 2864600Domain d1yhya2: 1yhy A:86-280 [123216]
    Other proteins in same PDB: d1yhya1, d1yhya3
    automated match to d1ybha2
    complexed with 1mm, fad, mg, nhe, p22

Details for d1yhya2

PDB Entry: 1yhy (more details), 2.7 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide, Metsulfuron methyl
PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1yhya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhya2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
nweqamrlpgymsrm

SCOPe Domain Coordinates for d1yhya2:

Click to download the PDB-style file with coordinates for d1yhya2.
(The format of our PDB-style files is described here.)

Timeline for d1yhya2: