SCOP 1.73: Domain d1yhwa1: 1yhw A:249-541

Lineage for d1yhwa1 (1yhw A:249-541)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein pak1 [56146] (1 species)
   OPK group; PAK/STE20 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56147] (2 PDB entries)

8. Domain d1yhwa1: 1yhw A:249-541 [123214]
   automatically matched to d1f3mc_
   mutant

Details for d1yhwa1

PDB Entry: 1yhw, 1.8 Å

PDB Description: Crystal Structure of PAK1 kinase domain with one point mutations (K299R)

PDB Compounds: (A:) Serine/threonine-protein kinase PAK 1

SCOP Domain Sequences for d1yhwa1:

Sequence; same for both SEQRES and ATOM records:

>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeat

Timeline for d1yhwa1:

• d1yhwa1 is new in SCOP 1.73
  
• d1yhwa1 appears in SCOP 1.75
  
• d1yhwa1 appears in the current release, SCOPe 2.07, called d1yhwa_