Lineage for d1yhwa1 (1yhw A:249-541)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735356Protein pak1 [56146] (1 species)
    OPK group; PAK/STE20 subfamily; serine/threonine kinase
  7. 735357Species Human (Homo sapiens) [TaxId:9606] [56147] (2 PDB entries)
  8. 735358Domain d1yhwa1: 1yhw A:249-541 [123214]
    automatically matched to d1f3mc_
    mutant

Details for d1yhwa1

PDB Entry: 1yhw (more details), 1.8 Å

PDB Description: crystal structure of pak1 kinase domain with one point mutations (k299r)
PDB Compounds: (A:) Serine/threonine-protein kinase PAK 1

SCOP Domain Sequences for d1yhwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeat

SCOP Domain Coordinates for d1yhwa1:

Click to download the PDB-style file with coordinates for d1yhwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yhwa1: