Lineage for d1yhta1 (1yht A:16-359)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094982Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2095031Protein Dispersin B, DspB [141788] (1 species)
    N-acetyl-beta-hexosaminidase
  7. 2095032Species Actinobacillus actinomycetemcomitans [TaxId:714] [141789] (1 PDB entry)
    Uniprot Q840G9 16-359
  8. 2095033Domain d1yhta1: 1yht A:16-359 [123213]
    complexed with acy, gol

Details for d1yhta1

PDB Entry: 1yht (more details), 2 Å

PDB Description: Crystal structure analysis of Dispersin B
PDB Compounds: (A:) DspB

SCOPe Domain Sequences for d1yhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]}
tkqtglmldiarhfyspeviksfidtislsggnflhlhfsdhenyaieshllnqraenav
qgkdgiyinpytgkpflsyrqlddikayakakgielipeldspnhmtaifklvqkdrgvk
ylqglksrqvddeiditnadsitfmqslmsevidifgdtsqhfhiggdefgysvesnhef
ityanklsyflekkglktrmwndglikntfeqinpnieitywsydgdtqdkneaaerrdm
rvslpellakgftvlnynsyylyivpkasptfsqdaafaakdviknwdlgvwdgrntknr
vqntheiagaalsiwgedakalkdetiqkntkslleavihktng

SCOPe Domain Coordinates for d1yhta1:

Click to download the PDB-style file with coordinates for d1yhta1.
(The format of our PDB-style files is described here.)

Timeline for d1yhta1: