Lineage for d1yhqz1 (1yhq Z:10-82)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751111Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 751112Protein Ribosomal protein L37ae [57831] (1 species)
  7. 751113Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)
  8. 751115Domain d1yhqz1: 1yhq Z:10-82 [123208]
    Other proteins in same PDB: d1yhq11, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1
    automatically matched to d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqz1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d1yhqz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOP Domain Coordinates for d1yhqz1:

Click to download the PDB-style file with coordinates for d1yhqz1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqz1: