SCOP 1.73: Domain d1yhqx1: 1yhq X:7-88

Lineage for d1yhqx1 (1yhq X:7-88)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)

8. Domain d1yhqx1: 1yhq X:7-88 [123206]
   Other proteins in same PDB: d1yhq11, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqy1, d1yhqz1
   automatically matched to d1ffku_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqx1

PDB Entry: 1yhq, 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1yhqx1:

Sequence; same for both SEQRES and ATOM records:

>d1yhqx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1yhqx1:

• d1yhqx1 is new in SCOP 1.73
  
• d1yhqx1 appears in SCOP 1.75
  
• d1yhqx1 appears in the current release, SCOPe 2.08