SCOP 1.73: Domain d1yhqu1: 1yhq U:4-56

Lineage for d1yhqu1 (1yhq U:4-56)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)

8. Domain d1yhqu1: 1yhq U:4-56 [123203]
   Other proteins in same PDB: d1yhq11, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
   automatically matched to d1ffkr_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqu1

PDB Entry: 1yhq, 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (U:) 50S ribosomal protein L24e

SCOP Domain Sequences for d1yhqu1:

Sequence; same for both SEQRES and ATOM records:

>d1yhqu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1yhqu1:

• d1yhqu1 is new in SCOP 1.73
  
• d1yhqu1 appears in SCOP 1.75
  
• d1yhqu1 appears in the current release, SCOPe 2.08