Lineage for d1yhqm1 (1yhq M:1-193)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716501Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 716502Protein Ribosomal protein L15e [54194] (1 species)
  7. 716503Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries)
  8. 716505Domain d1yhqm1: 1yhq M:1-193 [123195]
    Other proteins in same PDB: d1yhq11, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1s72m_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqm1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (M:) 50S ribosomal protein L15e

SCOP Domain Sequences for d1yhqm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqm1 d.12.1.2 (M:1-193) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggk

SCOP Domain Coordinates for d1yhqm1:

Click to download the PDB-style file with coordinates for d1yhqm1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqm1: