SCOP 1.73: Domain d1yhql1: 1yhq L:1-150

Lineage for d1yhql1 (1yhq L:1-150)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)

8. Domain d1yhql1: 1yhq L:1-150 [123194]
   Other proteins in same PDB: d1yhq11, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
   automatically matched to d1ffkj_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhql1

PDB Entry: 1yhq, 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (L:) 50S ribosomal protein L15P

SCOP Domain Sequences for d1yhql1:

Sequence, based on SEQRES records:

>d1yhql1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records):

>d1yhql1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

Timeline for d1yhql1:

• d1yhql1 is new in SCOP 1.73
  
• d1yhql1 appears in SCOP 1.75
  
• d1yhql1 appears in the current release, SCOPe 2.08