Lineage for d1yhqk1 (1yhq K:1-132)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123581Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 1123582Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 1123583Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 1123584Protein Ribosomal protein L14 [50195] (5 species)
  7. 1123624Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 1123628Domain d1yhqk1: 1yhq K:1-132 [123193]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1s72k_
    complexed with cd, cl, k, mg, na, sr, zit; mutant

Details for d1yhqk1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1yhqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1yhqk1:

Click to download the PDB-style file with coordinates for d1yhqk1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqk1: