Lineage for d1yhqj1 (1yhq J:4-145)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355845Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 1355846Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 1355847Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 1355848Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 1355886Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
    Uniprot P29198
  8. 1355890Domain d1yhqj1: 1yhq J:4-145 [123192]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1ffkg_
    complexed with cd, cl, k, mg, na, sr, zit; mutant

Details for d1yhqj1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d1yhqj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d1yhqj1:

Click to download the PDB-style file with coordinates for d1yhqj1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqj1: