Lineage for d1yhqf1 (1yhq F:1-119)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525848Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2525849Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2525866Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2525874Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2525878Domain d1yhqf1: 1yhq F:1-119 [123189]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, sr, zit; mutant

Details for d1yhqf1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: Crystal Structure Of Azithromycin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1yhqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d1yhqf1:

Click to download the PDB-style file with coordinates for d1yhqf1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqf1: