SCOP 1.73: Domain d1yhqe2: 1yhq E:80-172

Lineage for d1yhqe2 (1yhq E:80-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)

8. Domain d1yhqe2: 1yhq E:80-172 [123188]
   Other proteins in same PDB: d1yhq11, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqf1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
   automatically matched to d1ffk12
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqe2

PDB Entry: 1yhq, 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1yhqe2:

Sequence; same for both SEQRES and ATOM records:

>d1yhqe2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1yhqe2:

• d1yhqe2 is new in SCOP 1.73
  
• d1yhqe2 appears in SCOP 1.75
  
• d1yhqe2 appears in the current release, SCOPe 2.08