Lineage for d1yhqd1 (1yhq D:10-174)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200932Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2200933Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2200934Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2200935Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2200976Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
    Uniprot P14124
  8. 2200980Domain d1yhqd1: 1yhq D:10-174 [123186]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1ffkd_
    complexed with cd, cl, k, mg, na, sr, zit; mutant

Details for d1yhqd1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1yhqd1:

Sequence, based on SEQRES records: (download)

>d1yhqd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1yhqd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d1yhqd1:

Click to download the PDB-style file with coordinates for d1yhqd1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqd1: