Lineage for d1yhqc1 (1yhq C:1-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855325Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 2855326Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 2855327Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 2855328Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 2855366Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries)
    Uniprot P12735
  8. 2855370Domain d1yhqc1: 1yhq C:1-246 [123185]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1jj2c_
    complexed with cd, cl, k, mg, na, sr, zit; mutant

Details for d1yhqc1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (C:) 50S ribosomal protein L4E

SCOPe Domain Sequences for d1yhqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqc1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOPe Domain Coordinates for d1yhqc1:

Click to download the PDB-style file with coordinates for d1yhqc1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqc1: