Lineage for d1yhja_ (1yhj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904548Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2904549Protein Pyridoxal kinase [82516] (1 species)
  7. 2904550Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries)
  8. 2904559Domain d1yhja_: 1yhj A: [123177]
    automated match to d1rfua_
    complexed with r6c

Details for d1yhja_

PDB Entry: 1yhj (more details), 2.8 Å

PDB Description: Crystal Structure of Pyridoxal Kinase in Complex with Roscovitine and Derivatives
PDB Compounds: (A:) Pyridoxal kinase

SCOPe Domain Sequences for d1yhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhja_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
rvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelqel
ydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrngega
myvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtvvi
tssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamllawt
hkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiespei
vvqatvl

SCOPe Domain Coordinates for d1yhja_:

Click to download the PDB-style file with coordinates for d1yhja_.
(The format of our PDB-style files is described here.)

Timeline for d1yhja_: