Lineage for d1yhfa1 (1yhf A:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677513Family b.82.1.9: TM1287-like [89409] (4 proteins)
  6. 677514Protein Hypothetical protein SPy1581 [141591] (1 species)
  7. 677515Species Streptococcus pyogenes [TaxId:1314] [141592] (1 PDB entry)
  8. 677516Domain d1yhfa1: 1yhf A:1-112 [123176]

Details for d1yhfa1

PDB Entry: 1yhf (more details), 2 Å

PDB Description: Crystal Structure of Conserved SPY1581 Protein of Unknown Function from Streptococcus pyogenes
PDB Compounds: (A:) hypothetical protein SPy1581

SCOP Domain Sequences for d1yhfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]}
msyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspgdam
vtilsglaeitidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea

SCOP Domain Coordinates for d1yhfa1:

Click to download the PDB-style file with coordinates for d1yhfa1.
(The format of our PDB-style files is described here.)

Timeline for d1yhfa1: