Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.9: TM1287-like [89409] (5 proteins) |
Protein Hypothetical protein SPy1581 [141591] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [141592] (1 PDB entry) Uniprot Q99YR1 1-112 |
Domain d1yhfa1: 1yhf A:1-112 [123176] Other proteins in same PDB: d1yhfa2 |
PDB Entry: 1yhf (more details), 2 Å
SCOPe Domain Sequences for d1yhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} msyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspgdam vtilsglaeitidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea
Timeline for d1yhfa1: