Lineage for d1yhfa1 (1yhf A:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814807Family b.82.1.9: TM1287-like [89409] (5 proteins)
  6. 2814808Protein Hypothetical protein SPy1581 [141591] (1 species)
  7. 2814809Species Streptococcus pyogenes [TaxId:1314] [141592] (1 PDB entry)
    Uniprot Q99YR1 1-112
  8. 2814810Domain d1yhfa1: 1yhf A:1-112 [123176]
    Other proteins in same PDB: d1yhfa2

Details for d1yhfa1

PDB Entry: 1yhf (more details), 2 Å

PDB Description: Crystal Structure of Conserved SPY1581 Protein of Unknown Function from Streptococcus pyogenes
PDB Compounds: (A:) hypothetical protein SPy1581

SCOPe Domain Sequences for d1yhfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]}
msyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspgdam
vtilsglaeitidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea

SCOPe Domain Coordinates for d1yhfa1:

Click to download the PDB-style file with coordinates for d1yhfa1.
(The format of our PDB-style files is described here.)

Timeline for d1yhfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yhfa2