![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
![]() | Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
![]() | Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [89829] (10 PDB entries) |
![]() | Domain d1yhcb2: 1yhc B:134-279 [123171] automatically matched to d1xxea2 complexed with cac, cl, gol, pam, so4, zn; mutant |
PDB Entry: 1yhc (more details), 2.1 Å
SCOP Domain Sequences for d1yhcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhcb2 d.14.1.7 (B:134-279) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy sfrgghslnvklvkelakkq
Timeline for d1yhcb2: