Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [89829] (13 PDB entries) Uniprot O67648 3-270 |
Domain d1yhca2: 1yhc A:128-279 [123169] automated match to d1p42a2 complexed with cac, cl, gol, pam, so4, zn |
PDB Entry: 1yhc (more details), 2.1 Å
SCOPe Domain Sequences for d1yhca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhca2 d.14.1.7 (A:128-279) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp vkgkfysfrgghslnvklvkelakkq
Timeline for d1yhca2: