Lineage for d1yh8b1 (1yh8 B:2-127)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176854Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 2176855Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 2176856Species Aquifex aeolicus [TaxId:63363] [89829] (17 PDB entries)
    Uniprot O67648 3-270
  8. 2176893Domain d1yh8b1: 1yh8 B:2-127 [123162]
    automated match to d1p42a1
    complexed with cl, pam, zn

Details for d1yh8b1

PDB Entry: 1yh8 (more details), 2.7 Å

PDB Description: crystal structure of aquifex aeolicus lpxc deacetylase complexed with palmitate
PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d1yh8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yh8b1 d.14.1.7 (B:2-127) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei

SCOPe Domain Coordinates for d1yh8b1:

Click to download the PDB-style file with coordinates for d1yh8b1.
(The format of our PDB-style files is described here.)

Timeline for d1yh8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yh8b2