SCOPe 2.08: Domain d1yh5a2: 1yh5 A:1-100

Lineage for d1yh5a2 (1yh5 A:1-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.206: YggU-like [69785] (1 superfamily)
   beta(2)-loop-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243; some similarity to the Homing endonuclease-like fold

4. Superfamily d.206.1: YggU-like [69786] (1 family)

5. Family d.206.1.1: YggU-like [69787] (2 proteins)

6. Protein Hypothetical protein YggU [82745] (1 species)

7. Species Escherichia coli, o157 [TaxId:562] [82746] (2 PDB entries)

8. Domain d1yh5a2: 1yh5 A:1-100 [123159]
   Other proteins in same PDB: d1yh5a3
   automated match to d1n91a_

Details for d1yh5a2

PDB Entry: 1yh5

PDB Description: Solution NMR Structure of Protein yggU from Escherichia coli. Northeast Structural Genomics Consortium Target ER14.

PDB Compounds: (A:) orf, hypothetical protein

SCOPe Domain Sequences for d1yh5a2:

Sequence; same for both SEQRES and ATOM records:

>d1yh5a2 d.206.1.1 (A:1-100) Hypothetical protein YggU {Escherichia coli, o157 [TaxId: 562]}
mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflg
kqfrvaksqvviekgelgrhkqikiinpqqippevaalin

Timeline for d1yh5a2:

• d1yh5a2 first appeared in SCOP 1.73, called d1yh5a1
  
• d1yh5a2 appears in SCOPe 2.07