Lineage for d1yh2a1 (1yh2 A:1-154)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546109Species Human (Homo sapiens), E2 T [TaxId:9606] [143057] (1 PDB entry)
    Uniprot Q9NPD8 1-154
    Hspc150
  8. 2546110Domain d1yh2a1: 1yh2 A:1-154 [123158]
    Other proteins in same PDB: d1yh2a2

Details for d1yh2a1

PDB Entry: 1yh2 (more details), 2 Å

PDB Description: Ubiquitin-Conjugating Enzyme HSPC150
PDB Compounds: (A:) HSPC150 protein similar to ubiquitin-conjugating enzyme

SCOPe Domain Sequences for d1yh2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]}
mqrasrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviiper
ypfeppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsepnp
ddplmadissefkynkpaflknarqwtekharqk

SCOPe Domain Coordinates for d1yh2a1:

Click to download the PDB-style file with coordinates for d1yh2a1.
(The format of our PDB-style files is described here.)

Timeline for d1yh2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yh2a2