| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
| Species Human (Homo sapiens), E2 T [TaxId:9606] [143057] (1 PDB entry) Uniprot Q9NPD8 1-154 Hspc150 |
| Domain d1yh2a1: 1yh2 A:1-154 [123158] Other proteins in same PDB: d1yh2a2 |
PDB Entry: 1yh2 (more details), 2 Å
SCOPe Domain Sequences for d1yh2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]}
mqrasrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviiper
ypfeppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsepnp
ddplmadissefkynkpaflknarqwtekharqk
Timeline for d1yh2a1: