| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) ![]() contains extra C-terminal beta-hairpin |
| Family d.81.2.2: SerA intervening domain-like [143552] (1 protein) PfamB PB001360; this domain is found in some but not all D-3-phosphoglycerate dehydrogenases (SerA) and related enzymes |
| Protein D-3-phosphoglycerate dehydrogenase SerA [143553] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [143554] (2 PDB entries) Uniprot P0A544 316-450 |
| Domain d1ygyb4: 1ygy B:317-451 [123157] Other proteins in same PDB: d1ygya1, d1ygya2, d1ygya3, d1ygyb1, d1ygyb2, d1ygyb3 automated match to d1ygya4 complexed with tar |
PDB Entry: 1ygy (more details), 2.3 Å
SCOPe Domain Sequences for d1ygyb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygyb4 d.81.2.2 (B:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]}
ggvvneevapwldlvrklgvlagvlsdelpvslsvqvrgelaaeevevlrlsalrglfsa
viedavtfvnapalaaergvtaeickasespnhrsvvdvravgadgsvvtvsgtlygpql
sqkivqingrhfdlr
Timeline for d1ygyb4:
View in 3DDomains from other chains: (mouse over for more information) d1ygya1, d1ygya2, d1ygya3, d1ygya4 |