Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) contains extra C-terminal beta-hairpin |
Family d.81.2.2: SerA intervening domain-like [143552] (1 protein) PfamB 001360; this domain is found in some but not all D-3-phosphoglycerate dehydrogenases (SerA) and related enzymes |
Protein D-3-phosphoglycerate dehydrogenase SerA [143553] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [143554] (1 PDB entry) |
Domain d1ygyb4: 1ygy B:317-451 [123157] Other proteins in same PDB: d1ygya1, d1ygya2, d1ygya3, d1ygyb1, d1ygyb2, d1ygyb3 automatically matched to 1YGY A:317-451 complexed with tar |
PDB Entry: 1ygy (more details), 2.3 Å
SCOP Domain Sequences for d1ygyb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygyb4 d.81.2.2 (B:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]} ggvvneevapwldlvrklgvlagvlsdelpvslsvqvrgelaaeevevlrlsalrglfsa viedavtfvnapalaaergvtaeickasespnhrsvvdvravgadgsvvtvsgtlygpql sqkivqingrhfdlr
Timeline for d1ygyb4:
View in 3D Domains from other chains: (mouse over for more information) d1ygya1, d1ygya2, d1ygya3, d1ygya4 |