Lineage for d1ygyb4 (1ygy B:317-451)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) (S)
    contains extra C-terminal beta-hairpin
  5. Family d.81.2.2: SerA intervening domain-like [143552] (1 protein)
    PfamB PB001360; this domain is found in some but not all D-3-phosphoglycerate dehydrogenases (SerA) and related enzymes
  6. Protein D-3-phosphoglycerate dehydrogenase SerA [143553] (1 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [143554] (2 PDB entries)
    Uniprot P0A544 316-450
  8. Domain d1ygyb4: 1ygy B:317-451 [123157]
    Other proteins in same PDB: d1ygya1, d1ygya2, d1ygya3, d1ygyb1, d1ygyb2, d1ygyb3
    automated match to d1ygya4
    complexed with tla

Details for d1ygyb4

PDB Entry: 1ygy (more details), 2.3 Å

PDB Description: crystal structure of d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1ygyb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygyb4 d.81.2.2 (B:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]}
ggvvneevapwldlvrklgvlagvlsdelpvslsvqvrgelaaeevevlrlsalrglfsa
viedavtfvnapalaaergvtaeickasespnhrsvvdvravgadgsvvtvsgtlygpql
sqkivqingrhfdlr

SCOPe Domain Coordinates for d1ygyb4 are not available.

Timeline for d1ygyb4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ygyb1, d1ygyb2, d1ygyb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1ygya1, d1ygya2, d1ygya3, d1ygya4