Lineage for d1ygyb3 (1ygy B:452-529)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2560920Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 2560921Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 2560942Species Mycobacterium tuberculosis [TaxId:1773] [143374] (2 PDB entries)
    Uniprot P0A544 451-528
    there is an intervening domain between the substrate-binding domain and this domain
  8. 2560944Domain d1ygyb3: 1ygy B:452-529 [123156]
    Other proteins in same PDB: d1ygya1, d1ygya2, d1ygya4, d1ygyb1, d1ygyb2, d1ygyb4
    automated match to d1ygya3
    complexed with tar

Details for d1ygyb3

PDB Entry: 1ygy (more details), 2.3 Å

PDB Description: crystal structure of d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1ygyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygyb3 d.58.18.1 (B:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}
aqginliihyvdrpgalgkigtllgtagvniqaaqlsedaegpgatillrldqdvpddvr
taiaaavdayklevvdls

SCOPe Domain Coordinates for d1ygyb3:

Click to download the PDB-style file with coordinates for d1ygyb3.
(The format of our PDB-style files is described here.)

Timeline for d1ygyb3: