| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
| Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [143374] (2 PDB entries) Uniprot P0A544 451-528 there is an intervening domain between the substrate-binding domain and this domain |
| Domain d1ygyb3: 1ygy B:452-529 [123156] Other proteins in same PDB: d1ygya1, d1ygya2, d1ygya4, d1ygyb1, d1ygyb2, d1ygyb4 automated match to d1ygya3 complexed with tar |
PDB Entry: 1ygy (more details), 2.3 Å
SCOPe Domain Sequences for d1ygyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygyb3 d.58.18.1 (B:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}
aqginliihyvdrpgalgkigtllgtagvniqaaqlsedaegpgatillrldqdvpddvr
taiaaavdayklevvdls
Timeline for d1ygyb3:
View in 3DDomains from other chains: (mouse over for more information) d1ygya1, d1ygya2, d1ygya3, d1ygya4 |