| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
| Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
| Protein Phosphoglycerate dehydrogenase [52293] (2 species) has additional C-terminal domain of the ferredoxin fold |
| Species Mycobacterium tuberculosis [TaxId:1773] [142063] (2 PDB entries) Uniprot P0A544 2-97,282-315 there is an intervening domain between this domain and regulatory (C-terminal) domain |
| Domain d1ygyb2: 1ygy B:3-98,B:283-316 [123155] Other proteins in same PDB: d1ygya1, d1ygya3, d1ygya4, d1ygyb1, d1ygyb3, d1ygyb4 automated match to d1ygya2 complexed with tar |
PDB Entry: 1ygy (more details), 2.3 Å
SCOPe Domain Sequences for d1ygyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygyb2 c.23.12.1 (B:3-98,B:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
slpvvliadklapstvaalgdqvevrwvdgpdrdkllaavpeadallvrsattvdaevla
aapklkivaragvgldnvdvdaatargvlvvnaptsXastaeaqdragtdvaesvrlala
gefvpdavnvg
Timeline for d1ygyb2:
View in 3DDomains from other chains: (mouse over for more information) d1ygya1, d1ygya2, d1ygya3, d1ygya4 |