Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Phosphoglycerate dehydrogenase [51839] (2 species) has additional C-terminal domain of the ferredoxin fold |
Species Mycobacterium tuberculosis [TaxId:1773] [141927] (1 PDB entry) Uniprot P0A544 98-281 |
Domain d1ygyb1: 1ygy B:99-282 [123154] Other proteins in same PDB: d1ygya2, d1ygya3, d1ygya4, d1ygyb2, d1ygyb3, d1ygyb4 automatically matched to 1YGY A:99-282 complexed with tar |
PDB Entry: 1ygy (more details), 2.3 Å
SCOP Domain Sequences for d1ygyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygyb1 c.2.1.4 (B:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} nihsaaehalalllaasrqipaadaslrehtwkrssfsgteifgktvgvvglgrigqlva qriaafgayvvaydpyvsparaaqlgiellslddllaradfisvhlpktpetaglidkea laktkpgviivnaargglvdeaaladaitgghvraagldvfatepctdsplfelaqvvvt phlg
Timeline for d1ygyb1:
View in 3D Domains from other chains: (mouse over for more information) d1ygya1, d1ygya2, d1ygya3, d1ygya4 |