Lineage for d1ygya2 (1ygy A:3-98,A:283-316)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826403Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 826404Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 826428Protein Phosphoglycerate dehydrogenase [52293] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 826449Species Mycobacterium tuberculosis [TaxId:1773] [142063] (1 PDB entry)
    Uniprot P0A544 2-97,282-315
    there is an intervening domain between this domain and regulatory (C-terminal) domain
  8. 826450Domain d1ygya2: 1ygy A:3-98,A:283-316 [123151]
    Other proteins in same PDB: d1ygya1, d1ygya3, d1ygya4, d1ygyb1, d1ygyb3, d1ygyb4
    complexed with tar

Details for d1ygya2

PDB Entry: 1ygy (more details), 2.3 Å

PDB Description: crystal structure of d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis
PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1ygya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
slpvvliadklapstvaalgdqvevrwvdgpdrdkllaavpeadallvrsattvdaevla
aapklkivaragvgldnvdvdaatargvlvvnaptsXastaeaqdragtdvaesvrlala
gefvpdavnvg

SCOP Domain Coordinates for d1ygya2:

Click to download the PDB-style file with coordinates for d1ygya2.
(The format of our PDB-style files is described here.)

Timeline for d1ygya2: