Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
Protein Phosphoglycerate dehydrogenase [52293] (2 species) has additional C-terminal domain of the ferredoxin fold |
Species Mycobacterium tuberculosis [TaxId:1773] [142063] (1 PDB entry) Uniprot P0A544 2-97,282-315 there is an intervening domain between this domain and regulatory (C-terminal) domain |
Domain d1ygya2: 1ygy A:3-98,A:283-316 [123151] Other proteins in same PDB: d1ygya1, d1ygya3, d1ygya4, d1ygyb1, d1ygyb3, d1ygyb4 complexed with tar |
PDB Entry: 1ygy (more details), 2.3 Å
SCOP Domain Sequences for d1ygya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} slpvvliadklapstvaalgdqvevrwvdgpdrdkllaavpeadallvrsattvdaevla aapklkivaragvgldnvdvdaatargvlvvnaptsXastaeaqdragtdvaesvrlala gefvpdavnvg
Timeline for d1ygya2:
View in 3D Domains from other chains: (mouse over for more information) d1ygyb1, d1ygyb2, d1ygyb3, d1ygyb4 |