| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (5 families) ![]() has extra strand located between strands 2 and 3 |
| Family c.72.1.5: PfkB-like kinase [82515] (2 proteins) includes a variety of carbohydrate and pyrimidine kinases |
| Protein Pyridoxal kinase [82516] (1 species) |
| Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries) |
| Domain d1ygka1: 1ygk A:4-312 [123145] automatically matched to d1rfua_ complexed with rrc |
PDB Entry: 1ygk (more details), 2.6 Å
SCOP Domain Sequences for d1ygka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygka1 c.72.1.5 (A:4-312) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
eivvqatvl
Timeline for d1ygka1: