SCOP 1.75: Domain d1ygka1: 1ygk A:4-312

Lineage for d1ygka1 (1ygk A:4-312)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (2 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein Pyridoxal kinase [82516] (1 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries)

8. Domain d1ygka1: 1ygk A:4-312 [123145]
   automatically matched to d1rfua_
   complexed with rrc

Details for d1ygka1

PDB Entry: 1ygk, 2.6 Å

PDB Description: Crystal Structure of Pyridoxal Kinase in Complex with Roscovitine and Derivatives

PDB Compounds: (A:) Pyridoxal kinase

SCOP Domain Sequences for d1ygka1:

Sequence; same for both SEQRES and ATOM records:

>d1ygka1 c.72.1.5 (A:4-312) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
eivvqatvl

Timeline for d1ygka1:

• d1ygka1 first appeared in SCOP 1.73
  
• d1ygka1 is called d1ygka_ in SCOPe 2.01
  
• d1ygka1 appears in the current release, SCOPe 2.08, called d1ygka_