Lineage for d1ygka1 (1ygk A:4-312)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707937Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 707938Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 708085Family c.72.1.5: PfkB-like kinase [82515] (2 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 708086Protein Pyridoxal kinase [82516] (1 species)
  7. 708087Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries)
  8. 708105Domain d1ygka1: 1ygk A:4-312 [123145]
    automatically matched to d1rfua_
    complexed with rrc

Details for d1ygka1

PDB Entry: 1ygk (more details), 2.6 Å

PDB Description: Crystal Structure of Pyridoxal Kinase in Complex with Roscovitine and Derivatives
PDB Compounds: (A:) Pyridoxal kinase

SCOP Domain Sequences for d1ygka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygka1 c.72.1.5 (A:4-312) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
eivvqatvl

SCOP Domain Coordinates for d1ygka1:

Click to download the PDB-style file with coordinates for d1ygka1.
(The format of our PDB-style files is described here.)

Timeline for d1ygka1: