SCOP 1.73: Domain d1ygba2: 1ygb A:1-236

Lineage for d1ygba2 (1ygb A:1-236)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [103156] (5 PDB entries)

8. Domain d1ygba2: 1ygb A:1-236 [123141]
   Other proteins in same PDB: d1ygba1
   automatically matched to d1riqa2
   complexed with ser

Details for d1ygba2

PDB Entry: 1ygb, 2.48 Å

PDB Description: Crystal Structure of the catalytic fragment of alanyl-tRNA synthetase in complex with L-serine

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOP Domain Sequences for d1ygba2:

Sequence; same for both SEQRES and ATOM records:

>d1ygba2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

Timeline for d1ygba2:

• d1ygba2 is new in SCOP 1.73
  
• d1ygba2 appears in SCOP 1.75
  
• d1ygba2 appears in the current release, SCOPe 2.08