| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) |
| Protein automated matches [190149] (5 species) not a true protein |
| Species Escherichia coli [TaxId:562] [186874] (3 PDB entries) |
| Domain d1yg8v_: 1yg8 V: [123135] automated match to d1tyfa_ |
PDB Entry: 1yg8 (more details), 2.6 Å
SCOPe Domain Sequences for d1yg8v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yg8v_ c.14.1.1 (V:) automated matches {Escherichia coli [TaxId: 562]}
rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn
Timeline for d1yg8v_: