Lineage for d1yg6n1 (1yg6 N:17-193)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824390Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 824391Protein Clp protease, ClpP subunit [52098] (5 species)
  7. 824392Species Escherichia coli [TaxId:562] [52099] (4 PDB entries)
  8. 824406Domain d1yg6n1: 1yg6 N:17-193 [123113]
    automatically matched to d1tyfa_
    complexed with mpd

Details for d1yg6n1

PDB Entry: 1yg6 (more details), 1.9 Å

PDB Description: clpp
PDB Compounds: (N:) ATP-dependent Clp protease proteolytic subunit

SCOP Domain Sequences for d1yg6n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yg6n1 c.14.1.1 (N:17-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]}
fdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagmsi
ydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatdie
ihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn

SCOP Domain Coordinates for d1yg6n1:

Click to download the PDB-style file with coordinates for d1yg6n1.
(The format of our PDB-style files is described here.)

Timeline for d1yg6n1: