Lineage for d1yg6k_ (1yg6 K:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2460895Species Escherichia coli [TaxId:562] [186874] (4 PDB entries)
  8. 2460906Domain d1yg6k_: 1yg6 K: [123110]
    automated match to d1tyfa_
    complexed with mpd

Details for d1yg6k_

PDB Entry: 1yg6 (more details), 1.9 Å

PDB Description: clpp
PDB Compounds: (K:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d1yg6k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yg6k_ c.14.1.1 (K:) automated matches {Escherichia coli [TaxId: 562]}
sfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagms
iydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatdi
eihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn

SCOPe Domain Coordinates for d1yg6k_:

Click to download the PDB-style file with coordinates for d1yg6k_.
(The format of our PDB-style files is described here.)

Timeline for d1yg6k_: