Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein) |
Protein Clp protease, ClpP subunit [52098] (5 species) |
Species Escherichia coli [TaxId:562] [52099] (4 PDB entries) |
Domain d1yg6e1: 1yg6 E:11-193 [123104] automatically matched to d1tyfa_ complexed with mpd |
PDB Entry: 1yg6 (more details), 1.9 Å
SCOP Domain Sequences for d1yg6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yg6e1 c.14.1.1 (E:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} srgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvi tagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqg qatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilt hrn
Timeline for d1yg6e1: