SCOP 1.73: Domain d1yfzb1: 1yfz B:4-180

Lineage for d1yfzb1 (1yfz B:4-180)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [142552] (1 PDB entry)

8. Domain d1yfzb1: 1yfz B:4-180 [123099]
   automatically matched to 1YFZ A:3-180
   complexed with act, imp, mg; mutant

Details for d1yfzb1

PDB Entry: 1yfz, 2.2 Å

PDB Description: novel imp binding in feedback inhibition of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOP Domain Sequences for d1yfzb1:

Sequence; same for both SEQRES and ATOM records:

>d1yfzb1 c.61.1.1 (B:4-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]}
pmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpls
idflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkpr
slkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely

Timeline for d1yfzb1:

• d1yfzb1 is new in SCOP 1.73
  
• d1yfzb1 appears in SCOP 1.75
  
• d1yfzb1 appears in the current release, SCOPe 2.08, called d1yfzb_