SCOPe 2.01: Domain d1yfwa_: 1yfw A:

Lineage for d1yfwa_ (1yfw A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (1 protein)
   Pfam PF06052; 3-HAO

6. Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)

7. Species Ralstonia metallidurans [TaxId:119219] [141620] (4 PDB entries)
   Uniprot Q1LCS4 1-174

8. Domain d1yfwa_: 1yfw A: [123095]
   automated match to d1yfua1
   complexed with 4aa, fe, oxy, trs

Details for d1yfwa_

PDB Entry: 1yfw, 2 Å

PDB Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and O2

PDB Compounds: (A:) 3-hydroxyanthranilate-3,4-dioxygenase

SCOPe Domain Sequences for d1yfwa_:

Sequence; same for both SEQRES and ATOM records:

>d1yfwa_ b.82.1.20 (A:) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa

Timeline for d1yfwa_:

• d1yfwa_ first appeared in SCOP 1.73, called d1yfwa1
  
• d1yfwa_ was called d1yfwa1 in SCOP 1.75
  
• d1yfwa_ appears in SCOPe 2.02
  
• d1yfwa_ appears in the current release, SCOPe 2.08