Lineage for d1yfwa1 (1yfw A:1-174)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810149Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (1 protein)
    Pfam PF06052; 3-HAO
  6. 810150Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)
  7. 810154Species Ralstonia metallidurans [TaxId:119219] [141620] (4 PDB entries)
    Uniprot Q1LCS4 1-174
  8. 810156Domain d1yfwa1: 1yfw A:1-174 [123095]
    automatically matched to 1YFU A:1-174
    complexed with 4aa, fe, oxy, trs

Details for d1yfwa1

PDB Entry: 1yfw (more details), 2 Å

PDB Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and O2
PDB Compounds: (A:) 3-hydroxyanthranilate-3,4-dioxygenase

SCOP Domain Sequences for d1yfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfwa1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa

SCOP Domain Coordinates for d1yfwa1:

Click to download the PDB-style file with coordinates for d1yfwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yfwa1: