Lineage for d1yfta2 (1yft A:1-236)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532558Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2532559Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)
  7. 2532560Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries)
  8. 2532566Domain d1yfta2: 1yft A:1-236 [123093]
    Other proteins in same PDB: d1yfta1, d1yfta3
    automated match to d1riqa2
    protein/RNA complex; complexed with gly

Details for d1yfta2

PDB Entry: 1yft (more details), 2.23 Å

PDB Description: The crystal structure of the catalytic fragment of alanyl-tRNA synthetase in complex wtih glycine
PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfta2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

SCOPe Domain Coordinates for d1yfta2:

Click to download the PDB-style file with coordinates for d1yfta2.
(The format of our PDB-style files is described here.)

Timeline for d1yfta2: