![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries) |
![]() | Domain d1yfsa2: 1yfs A:1-236 [123089] Other proteins in same PDB: d1yfsa1, d1yfsa3, d1yfsb1, d1yfsb3 automated match to d1riqa2 protein/RNA complex; complexed with ala |
PDB Entry: 1yfs (more details), 2.08 Å
SCOPe Domain Sequences for d1yfsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfsa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]} slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf
Timeline for d1yfsa2: