Lineage for d1yfrb2 (1yfr B:1-236)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574234Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)
  7. 2574235Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries)
  8. 2574240Domain d1yfrb2: 1yfr B:1-236 [123087]
    Other proteins in same PDB: d1yfra1, d1yfra3, d1yfrb1, d1yfrb3
    automated match to d1riqa2
    protein/RNA complex; complexed with atp, mg

Details for d1yfrb2

PDB Entry: 1yfr (more details), 2.15 Å

PDB Description: crystal structure of alanyl-trna synthetase in complex with atp and magnesium
PDB Compounds: (B:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfrb2 d.104.1.1 (B:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

SCOPe Domain Coordinates for d1yfrb2:

Click to download the PDB-style file with coordinates for d1yfrb2.
(The format of our PDB-style files is described here.)

Timeline for d1yfrb2: