Lineage for d1yfrb1 (1yfr B:237-457)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780075Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 780076Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family) (S)
  5. 780077Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)
  6. 780078Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)
  7. 780079Species Aquifex aeolicus [TaxId:63363] [101356] (5 PDB entries)
  8. 780084Domain d1yfrb1: 1yfr B:237-457 [123086]
    Other proteins in same PDB: d1yfra2, d1yfrb2
    automatically matched to d1riqa1
    complexed with atp, mg

Details for d1yfrb1

PDB Entry: 1yfr (more details), 2.15 Å

PDB Description: crystal structure of alanyl-trna synthetase in complex with atp and magnesium
PDB Compounds: (B:) Alanyl-tRNA synthetase

SCOP Domain Sequences for d1yfrb1:

Sequence, based on SEQRES records: (download)

>d1yfrb1 a.203.1.1 (B:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1yfrb1 a.203.1.1 (B:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhpvyshlkelgktsafvgaaal

SCOP Domain Coordinates for d1yfrb1:

Click to download the PDB-style file with coordinates for d1yfrb1.
(The format of our PDB-style files is described here.)

Timeline for d1yfrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yfrb2